PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM10G09180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 330aa    MW: 34668.5 Da    PI: 6.2492
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM10G09180.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.92e-19104157356
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      k+++++ eq+++Le+ Fe+ +++  e++++LA+ lgL+ rqV +WFqNrRa++k
  OGLUM10G09180.1 104 KKRRLSVEQVRTLERSFESGNKLEPERKAQLARALGLQPRQVAIWFQNRRARWK 157
                      456899***********************************************9 PP

2HD-ZIP_I/II127.94.1e-41103194192
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                      ekkrrls eqv++LE+sFe+ +kLeperK++lar+Lglqprqva+WFqnrRAR+ktkqlEkd++aL+r++da ++en++L + +++L++e+ 
  OGLUM10G09180.1 103 EKKRRLSVEQVRTLERSFESGNKLEPERKAQLARALGLQPRQVAIWFQNRRARWKTKQLEKDFDALRRQLDAARAENDALLSLNSKLHAEIV 194
                      69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-1982160IPR009057Homeodomain-like
SuperFamilySSF466899.84E-2093161IPR009057Homeodomain-like
PROSITE profilePS5007117.31399159IPR001356Homeobox domain
SMARTSM003891.8E-19102163IPR001356Homeobox domain
PfamPF000461.1E-16104157IPR001356Homeobox domain
CDDcd000862.08E-16104160No hitNo description
PRINTSPR000314.6E-6130139IPR000047Helix-turn-helix motif
PROSITE patternPS000270134157IPR017970Homeobox, conserved site
PRINTSPR000314.6E-6139155IPR000047Helix-turn-helix motif
PfamPF021831.5E-9159198IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MASNGAAAGA MAPFFPPNFL LQMQQPLPLH HQHLQDHAHG GHGGHHLLPP PPPSLSPFLP  60
DLAMDAPPPP MYEASGGDGG GGGAASEDEE DGCGGGGGGG GGEKKRRLSV EQVRTLERSF  120
ESGNKLEPER KAQLARALGL QPRQVAIWFQ NRRARWKTKQ LEKDFDALRR QLDAARAEND  180
ALLSLNSKLH AEIVALKGGA AAAGGGGSSC RQEAASELIN LNVKETEASC SNRSENSSEI  240
NLDISRPAPP PPPPPANESP VNRGIPFYAS IGRGGAGGVD IDQLLSCPRR AAACSRRPRR  300
ATVPAAPPEM RGEESEGEGS EGERGEGEDK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1151159RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2877000.0AK287700.1 Oryza sativa Japonica Group cDNA, clone: J065130H05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613423.11e-138PREDICTED: homeobox-leucine zipper protein HOX23
SwissprotA2Z7341e-140HOX23_ORYSI; Homeobox-leucine zipper protein HOX23
SwissprotQ94GL51e-140HOX23_ORYSJ; Homeobox-leucine zipper protein HOX23
TrEMBLA0A0E0BA970.0A0A0E0BA97_9ORYZ; Uncharacterized protein
STRINGBGIOSGA032882-PA1e-138(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.12e-46HD-ZIP family protein